PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4579260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family S1Fa-like
Protein Properties Length: 73aa    MW: 7995.4 Da    PI: 10.1431
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4579260.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA99.12.8e-312473554
             S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskk 54
                        ++GlnPGlivllvv+glll+flvgny+ly+yaqk+lPPrkkkP+skk
  Lj1g3v4579260.1 24 DSGSQGLNPGLIVLLVVAGLLLTFLVGNYVLYTYAQKTLPPRKKKPISKK 73
                     45679********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.2E-282673IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MADDFEFSDK VPPSFDRVGN VVKDSGSQGL NPGLIVLLVV AGLLLTFLVG NYVLYTYAQK  60
TLPPRKKKPI SKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.112991e-122cell culture| pod
Lja.14891e-122cell culture| floral bud| pod| protoplast| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0102922e-87AP010292.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjB05O03, BM1994, complete sequence.
GenBankAP0102932e-87AP010293.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjB07N04, BM1879, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323459.13e-26DNA-binding protein S1FA3
SwissprotQ7XLX62e-14S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA9P8W53e-26A9P8W5_POPTR; DNA-binding protein S1FA3
STRINGPOPTR_0016s08890.19e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355